SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008800 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008800
Domain Number 1 Region: 203-445
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.71e-80
Family Eukaryotic proteases 0.0000000459
Further Details:      
 
Domain Number 2 Region: 42-99
Classification Level Classification E-value
Superfamily GLA-domain 3.36e-21
Family GLA-domain 0.00047
Further Details:      
 
Domain Number 3 Region: 99-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000617
Family EGF-type module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008800   Gene: ENSFCAG00000009488   Transcript: ENSFCAT00000009490
Sequence length 456
Comment pep:known genescaffold:CAT:GeneScaffold_1392:34858:44227:1 gene:ENSFCAG00000009488 transcript:ENSFCAT00000009490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQLSSLFLLVTIWGTSATPAPPDSVFSSRELSHRVLRIRKRANTFLEELRAGSLERECV
EEICDLEEAQEIFQNVDDTLAFWAKYIDEDQCAAPPPDHPCDSPCCGHGNCIDGISAFRC
DCDPGWEGRFCLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK
FPCGRPGRRMEKKRKTVKRDTSQADQIDPRLVNGKLSGWGESPWQVILLDSKKKLACGAV
LIHTSWVLTAAHCMEDSKKLMVRLGEYDLRRREKWELDLDIKEVLMHPNYSRSTSDNDIA
LLRLAQPAILSQTIVPICLPDSGLAERELTQAGQETVVTGWGHRSEAKRNRTFVLNFIKV
PVVPQNECINAMHNMISENMLCAGILGDSQDACEGDSGGPMVASFRGTSFLVGLVSWGEG
CGRLHNYGVYTKVSRYLDWIHSHIRAEEASLEGQVP
Download sequence
Identical sequences 9685.ENSFCAP00000008800 ENSFCAP00000008800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]