SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008809 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008809
Domain Number 1 Region: 566-827
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-89
Family Eukaryotic proteases 0.0000000195
Further Details:      
 
Domain Number 2 Region: 186-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-21
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 3 Region: 60-141
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000000458
Family SEA domain 0.009
Further Details:      
 
Domain Number 4 Region: 345-419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000157
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 
Domain Number 5 Region: 497-532
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 465-498
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000183
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 426-461
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 8 Region: 537-577
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000238
Family LDL receptor-like module 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008809   Gene: ENSFCAG00000009498   Transcript: ENSFCAT00000009500
Sequence length 828
Comment pep:novel genescaffold:CAT:GeneScaffold_558:121306:139805:1 gene:ENSFCAG00000009498 transcript:ENSFCAT00000009500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMKGIEEGVEFLPVNNTKKVEKRGPKRWVVLVAVLVGIFLLSLMTCFMVWHFQYQNARVQ
KVFNGYLRITNENFLDAYENSNSTEFANLASKVKEALKLLYSGVPTLGPYYKKSSVTAFS
EGSVIAYFWSEFSIPKYLVEEAESAMAKERVVTMPPRARALNSFVLTSVVAFPTDPRTVQ
TTQDNSCSFALHARSGEVTRFTTPGFPDSPYPARARCQWTLRGDADSVLSLTFRSFDVAP
CDDRGSDLVMVYDTLSPVEPRAVVQLCGTYPPSYNLTFLSSQNVLLVTLITNTERRHPGF
EATFFQLPKLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPNNQNVKVLFKLFYL
LEPNVPPGSCLKDYVEVNGEKYCGERSQFVVTSKSSKITVRFHSDQSYTDTGFLAEYLSY
DSSDPCPGMFMCNTGRCIRNELRCDGWADCTDYSDELNCQCNATYQFTCKNKFCKPLFWV
CDSVNDCGDNSDELQCSCPAQTFQCGNGKCVPQNQQCDGTDNCGDGSDEATCDRVTTVAC
TKHTYRCRNGLCVSKSNPECDGKKDCSDGSDEKDCDCGLRSFTRQSRVVGGKNADEGEWP
WQVSLHALGQGHVCGASIISPKWMVSAAHCFIDDKGFKYSDHTLWTAFLGLHDQSKRSAS
GVQELGLKRIISHPYFNDFTFDYDIALLELEQPAEYSSTVRPICLPEASHTFPTGKAIWV
TGWGHTQEGGSSALILQKGEIRVINQTTCESLLPQQITPRMMCVGYLSGGVDACRGDSGG
PLSSVEADGRIFQAGVVSWGEGCAQRDKPGVYTRLPVFRDWIKEQTGV
Download sequence
Identical sequences ENSFCAP00000008809 9685.ENSFCAP00000008809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]