SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009611 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009611
Domain Number 1 Region: 167-343
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000243
Family Pentraxin (pentaxin) 0.0092
Further Details:      
 
Domain Number 2 Region: 966-1135
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000284
Family Rhodopsin-like 0.025
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000009611
Domain Number - Region: 39-67
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000209
Family Spermadhesin, CUB domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009611   Gene: ENSFCAG00000010350   Transcript: ENSFCAT00000010354
Sequence length 1247
Comment pep:novel genescaffold:CAT:GeneScaffold_5221:36591:204767:1 gene:ENSFCAG00000010350 transcript:ENSFCAT00000010354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHSDQMWNCRWKWKPSSLPFFIALCLVYVPLSVWGCANCRVVLSNPSGTFTSPCYPNDY
PNSQACXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXAVSLRNQKVILPQTLDSYQVSVAKSVSIPELS
AFTLCFEATKIGKEDHEWTAFSYSNASSTQLLGFGKAKSGYFLSISGSKCFLNSVLPVKD
KEDIFTESFEQLCITWNNSLGFIGVNFKRNYEAVPCDSTINKVIPGNGKLLLGSSHNEIA
SLKGDIYNFRLWNFTMNSKILSNLSCNVKGNVVDWQNDFWNIPTLALKAESNLSCGSYLI
PLPATELANCADLGTLCQATVDSPSTTPPTVTTNMPVTNRIDKQRNDGIIFRISIVIQNI
LHHPEVKVQNKVAEWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVIWAL
LVYNATNNPSLEKDIQQKLLKNNESLDEXXXXXXXXXXXXXLCYADEDPKGYQWPLIPPS
VYNFPCPGKQGFYASRTCYRDLANTSLAYWGPPDISNCSREANEVANQILNLTGDGQTLS
SANITSIVEQVKRIVNKEENIDIMLGSTLMNIFSNILTSPDSDLLESSSEALKTIDELAF
KIDLNSTSRVNITTRNLALGVSSLSPGTNEISNFSIGLPSNNESYFQXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XNTYIRRYILKFCIIGWGLPALIVSIVLASKNQNEVYGKESYGKEQGDEFCWIQDPVIFY
VTCAGYFGVMFFLNVAMFIVVMVQICGRNGKRSNRTLREEVLRNLRSVVSLTFLLGMTWG
FAFFAWGPLNVPFMYLFSIFNSLQGLFIFIFHCAMKENVQKQWRRHLCCGRFRLADNSXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDKKGYCNAHSDNFYKNIIMSDTFSHSTKF
Download sequence
Identical sequences ENSFCAP00000009611 9685.ENSFCAP00000009611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]