SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009800 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009800
Domain Number 1 Region: 42-243
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-49
Family Eukaryotic proteases 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009800   Gene: ENSFCAG00000010556   Transcript: ENSFCAT00000010559
Sequence length 243
Comment pep:novel scaffold:CAT:scaffold_194972:114860:128385:1 gene:ENSFCAG00000010556 transcript:ENSFCAT00000010559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLSILLLVSQAKGVHLGMWPPPVVRVALPGGAGHDNGPSHHFHLVNECGKRPIFEEGT
QYSRIIGGMEAEVGEFPWQVSIQARNEHFCGGAIINEWWIVTAAHCLFYEDLSPMDLSVV
LGTNDXXXXXXXXXXXXXXXXXXXXXRVNMDNDIALLLLALPITFSGLKEPICPRKLSPS
MWHKCWVAGWGQTNTDDKNSMKTDLMKVPMIIMDWKKCSKAFPRLTKNMLCAGYENESFD
ACQ
Download sequence
Identical sequences 9685.ENSFCAP00000009800 ENSFCAP00000009800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]