SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009841 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009841
Domain Number 1 Region: 95-283
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.25e-56
Family Eukaryotic proteases 0.000000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009841   Gene: ENSFCAG00000010600   Transcript: ENSFCAT00000010603
Sequence length 283
Comment pep:novel genescaffold:CAT:GeneScaffold_731:46227:53390:1 gene:ENSFCAG00000010600 transcript:ENSFCAT00000010603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEMLPTAILLVLAVSVVAKDNATCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVYDWRLIFGAREIVYGSDKPVKPPQ
QERYVEKIIIHEKYVPSLEYNDIALLKITPPVPCGQFIGPGCLPQFRAGPPRVSQACWVA
GWGFLRENAYRTSPTLQEARVNLIDLDLCNSTQWYNGRIRSTNVCAGYPEGKIDTCQGDS
GGPLMCRDNVANTYVVVGVTSWGVGCARAKRPGVYTATWPYLN
Download sequence
Identical sequences 9685.ENSFCAP00000009841 ENSFCAP00000009841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]