SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009948 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009948
Domain Number 1 Region: 704-769
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000135
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 763-825
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000667
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 831-890
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000904
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 4 Region: 351-412
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000138
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 587-630
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000068
Family Spermadhesin, CUB domain 0.0044
Further Details:      
 
Domain Number 6 Region: 526-589
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000117
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 7 Region: 405-526
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000672
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000009948
Domain Number - Region: 300-352
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0327
Family Spermadhesin, CUB domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009948   Gene: ENSFCAG00000010712   Transcript: ENSFCAT00000010715
Sequence length 983
Comment pep:novel genescaffold:CAT:GeneScaffold_715:130392:221875:1 gene:ENSFCAG00000010712 transcript:ENSFCAT00000010715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAQEGDAGPSGASLLPSGALESSSMSKESREERVTTAPPNPAQSGEDLSEPGLQGTAPSA
ALSTALPEEAATKRALPSGKRLPSLKQVNSARKQLRPKATSAAAVQRALSQPASSGPGLL
SSATEKPRPPGDPEPAASEEPLWLDRKAGADPTTPAPLQISPFTSRPYVAHTLPQQPDPG
EPSVPDDPHEASPEDASPMTWMDKGESELTGSASEESQETTTSTIITTTVITTEQAPXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVKSVNLSDGELLSIRGVD
GPTLTVLANQTLLVEGQVIRSPTNTISVYFRTFQDDVFGNFQLHYQAFMLSCSFPRRPDY
GDVTVMDLHSGGVAHFHCHLGYELQGAKTLTCINASKPHWSSQEPICSAPCGGAVHNATI
GRVLSPSYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMVYSGLINKSALLYD
SLQTESVPFEGLLSEGNSIRIEFTSDQARAASAFNIRFEAFEKGHCYEPYIQNGNFTTSD
PTYNIGTIVEFTCDPGHSLEQGPAIIECINVRDPYWNDTEPLCRATCGGELSAVAGVVLS
PNWPEPYVEGEDCIWKIHVGEEKRIFLDIQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSRNDSCSDLPEIQNGWKTTSHT
ELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVDHSTRLISD
PVLLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPEN
GYQILYKRLYLPGESLTFMCYEGFELMGEVTIRCLLGQPSHWNGPLPVCKVNQDSFEHAL
EVAEAAAETSLEGGNMALAIFIPVLIISLLLGGAYIYITRCRYYSSLRLPLMYSHPYSQI
TVETEFDNPIYETGETREYEVSI
Download sequence
Identical sequences 9685.ENSFCAP00000009948 ENSFCAP00000009948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]