SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009958 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009958
Domain Number 1 Region: 320-492,529-604
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-28
Family Prokaryotic proteases 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009958   Gene: ENSFCAG00000010723   Transcript: ENSFCAT00000010725
Sequence length 613
Comment pep:novel scaffold:CAT:scaffold_135179:244:3718:1 gene:ENSFCAG00000010723 transcript:ENSFCAT00000010725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPTKRRSQKIAFDEKRNMKIDHYFHQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKHKLTHSEEKSFYAALNTLKAVKEEIET
QQGKEMLAVGKEGIEGYINLGMPLSCFPESCHVQITFVRSRSKQKEGNQVFGRHEKASAD
CVKFYIHAIGKRKKRIVKRRQLHKEGCKLCVYAFRGETIKDALCKDGRFVSFLEKEDWRL
IRNLDSILESTQTVDDLEGKLFEVEVEKGMSSRAVATQKSESEKGNTSVLREEIVAQYPS
LKRESEKIRENFKKEMKSKKSKTSLFKLLKVKFGKMTRNSTPIRVHNFLSLVGNSVGYLS
WDNNGNKGCATCYVFKELYIFTCRHIVSDFMGEGIEPSKWADVIGQCARVTFRYNSFPEK
DENCFFLEPWFEISDATLDYAVLKLKANGQQVPLGLYSRIARAPSTGLIYIIGHPNGEEK
SSDACTVISQGQREKKYEEYLQAGKGEGSEYIHMCTRKTFEEIAHSPDVITYDTSFYFGA
SGSPVLDSEGSLVAMHTAGFTCDNEIGLSSHVIEFGSTLESILLDIKENHRQWYTEVCIS
PQDVEMVSDEDGW
Download sequence
Identical sequences 9685.ENSFCAP00000009958 ENSFCAP00000009958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]