SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010129 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010129
Domain Number 1 Region: 508-823
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-77
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 131-245
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 291-403
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-30
Family Spermadhesin, CUB domain 0.0000222
Further Details:      
 
Domain Number 4 Region: 241-289
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 5 Region: 472-530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000097
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010129
Domain Number - Region: 407-446
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000625
Family Complement control module/SCR domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010129   Gene: ENSFCAG00000010906   Transcript: ENSFCAT00000010907
Sequence length 835
Comment pep:novel genescaffold:CAT:GeneScaffold_3997:116906:174041:-1 gene:ENSFCAG00000010906 transcript:ENSFCAT00000010907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQPHRIKEGTGRADLFGKKTDSVAGFLVVRVRGEREERGKGRGREGERGSVAGRGRRDLN
GECQPIPETHRDLRTKIRHRHHTGDKLTGKSDRGDQGQAARSTQGWKMRWLLLCHALCLS
LLKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPEGFRIKLYFMHFNLESSYLC
EYDYVKVETEEQVLATFCGRETTDTEQTPGQEVVFSPGSFMSITFRSDFSNEERFTGFDA
HYMAVDVDECTEREDEELSCDHYCHNYIGGYYCSCRFGYLLHTDNRTCRVECSDNLFTQR
TGVITSPDFPNPYPKSSECFYTIELEEGFMVSLQFEDIFDIEDHPEVPCPYDYIKIKADP
KVWGPFCGERAPEPINTQSHSVQILFRSDNSGENRGWRLSYRATGNECPDLQPPVHGKIE
PLQAKYSFKDQVLISCDTGYKVLKXXXXXXXXXXXXXXXXXXXXXXXXXXXADCGAPAEL
KHGQITFSTRNKLTTYKSEIRYSCQQPYYKMLHNITGIYTCSAQGVWMNEVLGRSQPTCL
PVCGQPSRSLPNLVKRIIGGRNAEPGLFPWQALIVVEDTSRVPNDKWFGSGALLSESWIL
TAAHVLRSQRRDNTVTPVSKEHVTVYLGLHDVRDKSGAVNSSAAQVVLHPDFNIQNYNHD
IALVQLQEPVPLGPHVMPICLPSPEPEGPEPHMLGLVAGWGISNPNVTVDEIISSGTRTL
SDVLQYVKLPVVPHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCLGDSGGAFVILDD
LTQRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWLWEQMGSPQGLGALQVER
Download sequence
Identical sequences 9685.ENSFCAP00000010129 ENSFCAP00000010129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]