SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010316 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010316
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily Cupredoxins 1.76e-38
Family Ephrin ectodomain 0.00000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010316   Gene: ENSFCAG00000011104   Transcript: ENSFCAT00000011107
Sequence length 186
Comment pep:novel genescaffold:CAT:GeneScaffold_5217:6793:52236:-1 gene:ENSFCAG00000011104 transcript:ENSFCAT00000011107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWEC
NRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYIXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXDTVHESAEPSRGENAAQTPRIPSRLLAILLFLL
AMLLTL
Download sequence
Identical sequences 9685.ENSFCAP00000010316 ENSFCAP00000010316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]