SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010623 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010623
Domain Number 1 Region: 87-143
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000262
Family ATI-like 0.011
Further Details:      
 
Domain Number 2 Region: 281-316
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000589
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000010623
Domain Number - Region: 28-78
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010623   Gene: ENSFCAG00000011433   Transcript: ENSFCAT00000011436
Sequence length 451
Comment pep:novel genescaffold:CAT:GeneScaffold_2007:138760:152223:1 gene:ENSFCAG00000011433 transcript:ENSFCAT00000011436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LARADPTCNSTFLHLDTQACYRGPCLEECVWSSWSSWTRCSCRVLVQQRYRHQGPGPGGA
GTGAGPPCTRLDGHFRPCPLGNCSEDSCTPPFEFQACGSPCAGLCATHLSRRLCQDLPPC
QPGCYCPEGLLEQAGGCIPPEQCSCLHITGEGARVTLAPGDRLQLGCKECECRRGELKCT
SQGCQGLLPLSGWSEWSPCGPCLPPGVLAPASRTALEERRSQHPAGLSPTLAPLLASEQH
RHRLCLDPETGRPWAGDPDLCIAPLSQQRLCPDPRACHDLCQWSPWGPWSPCQVSCSGGF
RLRWREAGGPPGGGCWGPWADELQRGALPRGELSPGHRAHPLCQPVPKLCGPLGPCAVSA
GTMPSRLPLPPWPTGTGWALCAHLLLPLWPPQPQCLMGGGPRRGGTAGLQKLHLYQRVPG
VPTPVPSPWALVSLEQLLCSLWWGQHGATEL
Download sequence
Identical sequences ENSFCAP00000010623 9685.ENSFCAP00000010623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]