SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010920 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010920
Domain Number 1 Region: 191-432
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.54e-84
Family Eukaryotic proteases 0.00028
Further Details:      
 
Domain Number 2 Region: 101-198
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000876
Family Hepsin, N-terminal domain 0.033
Further Details:      
 
Domain Number 3 Region: 54-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010920   Gene: ENSFCAG00000011765   Transcript: ENSFCAT00000011768
Sequence length 436
Comment pep:novel genescaffold:CAT:GeneScaffold_4051:680273:700949:1 gene:ENSFCAG00000011765 transcript:ENSFCAT00000011768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQDPGSDQPLNSFDVTPLRKPRTPLETFKKVGVPIIAALLSLATIIITAVLVKVILDKYY
FLCGQPLHFIPRKQVCDGQQDCASGEDEQLCVKNFPDGSPVTVRLSRDRSTLQVLDPATG
SWVSACFDNFTEALAEIACGQMGYDSKPSFKAVGIGPDQDLDVAGITENSQELQVRNLSG
PCLSGSLVSLHCLACGESLKSPRVVGGEAASVDSWPWQVSIQYNKQHICGGSILDPHWIL
TAAHCFRKHLDVPNWKVRAGSDKLGNFPSLPVADIFVIEFNTTYPKEKDIALVKLQFPLT
FSGTVRPICLPFFDEELPPATPLWVIGWGFTEQDGGKMSDTLLQASVQVIDHARCNAEDA
YQGEVTEKMLCAGILEGGVDTCQGDSGGPLMYHSDLWQVVGIVSWGHGCGGPSTPGVYTK
VTSYLDWIYSVRKSTL
Download sequence
Identical sequences ENSFCAP00000010920 9685.ENSFCAP00000010920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]