SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010975 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010975
Domain Number 1 Region: 294-501
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.19e-50
Family Eukaryotic proteases 0.00033
Further Details:      
 
Domain Number 2 Region: 246-277
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000266
Family Kringle modules 0.0045
Further Details:      
 
Domain Number 3 Region: 148-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000612
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 68-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000385
Family EGF-type module 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010975   Gene: ENSFCAG00000011829   Transcript: ENSFCAT00000011832
Sequence length 501
Comment pep:novel genescaffold:CAT:GeneScaffold_2774:337722:370176:1 gene:ENSFCAG00000011829 transcript:ENSFCAT00000011832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARMCHLHIVLVTALVGKAAIGFSLMSLLVDPDPDWTPDYYESSYEYYNHEENSSDTLA
YQENPNWYYTEEDPCLDHPCKRNGDCLVSGDTFTCSCPAPFSGHRCQNXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXVPACRPNPCQNGGICSRHKRRTKFVCTCPEQF
KGKFCEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXNPDGDEKPWCFIKVNNAKVKWEYCDIPACSALDIADPEGSPTEPLSKLPGFDSCR
KTEMGKVKRIYGGFKSTAGKHPWQASLQTSPLTASMPQGHFCGGSLIHPCWVLTAAHCTD
IKTKHLKVVLGDQDLKKTEFHEQRFGVEKIFKYSHYNERDEIPHNDIALLKLKPVDGHCA
LESKYVKTVCLPDGAFPSGTECHISGWGVTETGEGSRQLLDAKVKLIASTLCNSHRLYDH
MIDNSMICAGNLQKPGKDSCQ
Download sequence
Identical sequences 9685.ENSFCAP00000010975 ENSFCAP00000010975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]