SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011020 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011020
Domain Number 1 Region: 7-230
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.84e-89
Family Eukaryotic proteases 0.000000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011020   Gene: ENSFCAG00000011878   Transcript: ENSFCAT00000011881
Sequence length 233
Comment pep:novel scaffold:CAT:scaffold_122831:1757:5671:-1 gene:ENSFCAG00000011878 transcript:ENSFCAT00000011881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AFPTDDDDKIVGGYTCEENSIPYQVSLNSGYHFCGGSLISDQWVVSAAHCYKSRIQVRLG
EHNIEVLEGDEQFINSAKVIRHPRFNSWTLDYDIMLIKLSSPAALTGQVSTISLPSACAP
AGTQCLISGWGNTLSSGTNYPELLQCLDAPLLSQDQCKAAYPGQITENMVCAGFLEGGKD
SCQGDSGGPVVCRGELQGIVSWGYGCAQKNKPGVYTKVCNFTDWIKETIAANS
Download sequence
Identical sequences ENSFCAP00000011020 9685.ENSFCAP00000011020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]