SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011255 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011255
Domain Number 1 Region: 771-879
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-24
Family Spermadhesin, CUB domain 0.0024
Further Details:      
 
Domain Number 2 Region: 214-251,296-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000251
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 133-251
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000408
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 4 Region: 6-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000898
Family EGF-type module 0.043
Further Details:      
 
Domain Number 5 Region: 646-768
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000246
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011255   Gene: ENSFCAG00000012132   Transcript: ENSFCAT00000012135
Sequence length 957
Comment pep:novel genescaffold:CAT:GeneScaffold_727:214660:360641:-1 gene:ENSFCAG00000012132 transcript:ENSFCAT00000012135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVDVDECSEGTDDCHIDAICQNTPKSYKCLCKPGYKGEGRQCEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXGMNCMNKDHGCAHICRETPKGGVACDCRPGFDLAQNQKDCTLTCNYGN
GGCQHSCEDTDTGPMCGCHQKYALHSDGRTCIETCAVNNGGCDRTCRDTATGVRCSCPVG
FTLQPDGKTCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECSFE
RTCDHICINSPGSFQCLCHRGYILYGTTHCGDVDECSMNNGSCDQGCVNTKGSYECVCPP
GRRLHWNRKDCVETGRCLSRAKASTWAQLSCSRVGGVERCSLFCPAHSLFVPDSENSYSL
SCGVPGLQGKTPQKRNSTSSSAGPSCSGAPASIRQKARFKIRDARCRLWAHSQEPPKEAP
RQPLLENCHVTFVNFKCDSSKKRRRGRKSPSKEVTHITAEFEVEAKTDEASDTCEADCMR
KRAEQSLQAAIKTLRRSIGRQLFSIQVAGTEYAMAQWPAKAPEGPGACSTGQVLQDGKCX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDGFGLDGARNVSECRGQCSPGF
FSPDGFRPCQACPVGTYQPEPGRTGCFPCGGGILTKHEGTASFQDCEARVHCSPGHHYNT
TTHRCIRCPVGTYQPEFGQNHCITCPGNTSTDFDGSTNVTHCKNQHCGGELGDYTGYIES
PNYPGDYPANTECVWHISPPPKRRILIVVPEIFLPVEDECGDVLVMMKSASPTSITTYET
CQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASE
NHQEILKDKKLIKALFDVLAHPQNYFKYTAQESKEMFPRSFIKLLRSKVSRFLRPYK
Download sequence
Identical sequences ENSFCAP00000011255 9685.ENSFCAP00000011255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]