SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011489 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011489
Domain Number 1 Region: 66-321
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.84e-71
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-29
Family Nuclear receptor 0.0000902
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011489   Gene: ENSFCAG00000012385   Transcript: ENSFCAT00000012388
Sequence length 335
Comment pep:novel scaffold:CAT:scaffold_149291:25750:31227:1 gene:ENSFCAG00000012385 transcript:ENSFCAT00000012388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKC
LKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQ
CMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQ
CSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIV
LFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIE
QLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ
Download sequence
Identical sequences ENSFCAP00000011489 9685.ENSFCAP00000011489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]