SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011691 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011691
Domain Number 1 Region: 16-99
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.25e-31
Family Nuclear receptor 0.00013
Further Details:      
 
Domain Number 2 Region: 84-98,232-340
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-27
Family Nuclear receptor ligand-binding domain 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011691   Gene: ENSFCAG00000012604   Transcript: ENSFCAT00000012606
Sequence length 341
Comment pep:novel genescaffold:CAT:GeneScaffold_1442:239845:309588:1 gene:ENSFCAG00000012604 transcript:ENSFCAT00000012606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNC
QIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKGPMYKRDRALKQQKKALIRAN
GLKLEAMSQVIQAMPSELTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTM
PPHGSLQGYQTYSHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELL
KCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFREL
KVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQ
Download sequence
Identical sequences ENSFCAP00000011691 9685.ENSFCAP00000011691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]