SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011780 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011780
Domain Number 1 Region: 282-531
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.7e-89
Family Eukaryotic proteases 0.0000495
Further Details:      
 
Domain Number 2 Region: 152-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011780   Gene: ENSFCAG00000012705   Transcript: ENSFCAT00000012708
Sequence length 537
Comment pep:novel genescaffold:CAT:GeneScaffold_4298:926464:958867:-1 gene:ENSFCAG00000012705 transcript:ENSFCAT00000012708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQASGPQPLLPLLCGRRHQKAWIFSSLTRSCPREPGKGCVYRKLQIRWVSIPSLVPYTFL
GHGHYEVEVDVEPSLRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVAPDADAVAA
QIMSLLQLKFFPIIVIGIIALILALAIGLDIHFDCSGKYRCRSSFKCIELTARCDGVSDC
RDGEDEYRCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVSSDALRV
DLVEERLQGDFASINHLLPDDKVTALHHSVYVREECASGHVVALKCMACGLRMGYSSRIV
GGNVSSLAQWPWQASLQFQGYHLCGGSVITPVWVVTAAHCVHDLYIPKSWTIQVGLVSLL
DSPAPSHLVEKIIYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEEQFPDGKMC
WTSGWGATEDGAGDASPVLNHAAVPLLSNKICNHRDVYGGIVSPSMLCAGYLKGGVDSCQ
GDSGGPLVCQERRVWKLVGATSFGIGCADVNKPGVYTRITSFLDWIHEQLERDLKTR
Download sequence
Identical sequences ENSFCAP00000011780 9685.ENSFCAP00000011780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]