SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011890 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011890
Domain Number 1 Region: 20-143
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.44e-27
Family Nuclear receptor ligand-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011890   Gene: ENSFCAG00000012821   Transcript: ENSFCAT00000012824
Sequence length 147
Comment pep:novel genescaffold:CAT:GeneScaffold_4321:1573282:1574524:-1 gene:ENSFCAG00000012821 transcript:ENSFCAT00000012824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APVPSILKKILLEEPSSSSGSGQLPDRPQPSLAAVQWLQCCLESFWSLQLGPKEYAYLKE
TILFNPGVPGLHASSHVGHLQQKAHHALCKALETWCPAGQGRLARVLLTASTLKSIPPSL
LGDLFFRPIVGDTDIAGLLEDMLLLSQ
Download sequence
Identical sequences 9685.ENSFCAP00000011890 ENSFCAP00000011890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]