SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011920 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011920
Domain Number 1 Region: 15-262
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.5e-88
Family Eukaryotic proteases 0.0000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011920   Gene: ENSFCAG00000012853   Transcript: ENSFCAT00000012857
Sequence length 264
Comment pep:novel genescaffold:CAT:GeneScaffold_858:105046:106983:-1 gene:ENSFCAG00000012853 transcript:ENSFCAT00000012857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLSLTLSLGLLGSSWGCGIPAIKPVLSFSQRIVNGENAVPGSWPWQVSLQDSSGFHFC
GGSLISQSWVVTAAHCKVTPGRHFVVLGEYDRSSNAEPLQVLSISKAITHPFWNPTTLNN
DLTLLKLASPAQYTKRITPVCLASPNEALPAGLTCATTGWGRLSGVGNVTPARLQQVALP
LVTVSQCRQYWGSRITDSMICAGGSGASSCQGDSGGPLVCQKGNTWVLIGVVSWGTSNCN
VQKPAIYTRVSKFSTWINQIIAYN
Download sequence
Identical sequences XP_006941698.1.62641 ENSFCAP00000011920 9685.ENSFCAP00000011920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]