SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012232 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012232
Domain Number 1 Region: 683-790
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.94e-38
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 373-477
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-37
Family Spermadhesin, CUB domain 0.00023
Further Details:      
 
Domain Number 3 Region: 255-366
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-36
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 4 Region: 524-632
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-34
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 5 Region: 814-908
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.93e-17
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 6 Region: 634-676
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000161
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 7 Region: 480-522
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000145
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 79-117
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000099
Family Astacin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012232   Gene: ENSFCAG00000013188   Transcript: ENSFCAT00000013193
Sequence length 919
Comment pep:novel genescaffold:CAT:GeneScaffold_181:201886:354519:1 gene:ENSFCAG00000013188 transcript:ENSFCAT00000013193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFGDHSMSKKRGALYQLIDRIRRIGSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXSQRAMFKQAMRHWEKHTCVTFIERSDEESYIVFTYRPCGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXCGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTM
DLYKSSLCWYDYIEVRDGCWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGF
AAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSEDYYVGLTFQAFEIERHDN
CAYDYLEVRDGNSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKE
EDECAKPDRGGCEQRCLNTLGSYQCVCEPGYELGPDKRGCEAACGGLLTKLNGTITTPGW
PKEYPPNKNCVWQVVAPTQYRISMKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCG
AEVPEVITSQFNNMRIEFRSDNTVSKKGFKAHSSDKDECSKDNGGCQHECVNTMGSYMCQ
CRNGFVLHENKHDCKEAECEQKIHSPSGFITSPNWPDKYPSRKECTWEISTTPGHRIKLA
FSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGSKIPEPLVATGNKMFVRFISDASVQ
RKGFQATHSTECGGRLKAEPKPRDLYSHAQFGDNNYPGQVDCEWLVVSERGFRLELSFPI
FEVEEEADCGYDYVSXXXXXXXXXXXXXXXXXXXXPPEEIYSIGDAVLIHFHTDDTINKK
GFHIRYKSIRYPDTMHTKK
Download sequence
Identical sequences 9685.ENSFCAP00000012232 ENSFCAP00000012232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]