SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012287 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012287
Domain Number 1 Region: 41-237
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-26
Family Clostridium neurotoxins, the second last domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012287   Gene: ENSFCAG00000013250   Transcript: ENSFCAT00000013254
Sequence length 1728
Comment pep:novel genescaffold:CAT:GeneScaffold_3837:65612:406593:-1 gene:ENSFCAG00000013250 transcript:ENSFCAT00000013254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLGAHRTRRGKVSHTAKTKLLLHFIVLCVADSAVHAQEQGIDILHQLGLGDKDVRHSSS
VTAVPSSSTPLPQGVHLTESGVILTNDAYIESPLMKILPFNLEQPFTILIGLQSYRVNNA
FLFSIRNKNRLQLGVQLLPKKLVVYLGGKQSVFFNYSVHDERWHFFAITIRNQVVSMSVE
CGKKYFSRETLLEVQTFDSNSVFTLGSMNNNSVHFEGIVCQLDIIPSAEASANYCRYVKH
RCHPETNHLHTTIVPAEILENSPLPKQFGEKVLSEDTFTKGKNIPNIINNDSATVHKQQE
HQISKSQFISLHSRNVSAVDLVNHGIQDKEMITEEHTQTNLSLSMTHHLKKAKTNSKEKF
SSFSNVSDNVTQHNDKLTGLSPFKKISSILPHIKQETITNLKKAITANLHTNELMELQQI
LNTTLYRVTDEPSVDNHLDLRKEGEIDPDATYPIENSYETDLYDYYYYYEDLNTMLEMEN
LRGPKGDTGPPGPPGPAGIPGPSGRRGPRGIPGPHGNPGLPGLPGPKGPKGDPGLSPGQA
VPGKKGSQGLSGLMGPPGMQGDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVAG
PEGNPGPKGIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGLVGSIGPPGFPGLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEVGDQG
NVGKIGETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXGERGSPGPQGPQGEKGVMXXXXXXXXXXXXXXXXXXGHVGARGPPGSQGPKGQ
RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGKTGNPGERGIQGKPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXGPSGIEGEAGLQGEPGAKXXXXXXGNVGVAGEPGL
RXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSEGI
VGIPGQRGRPGKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXGYPGEDSTVLGPPGPRGEPXXXXXXXXXXXXXXXX
XXGHMGIPGPRGATGQQGPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTRGSPGRAGPAGSPGPRGAKGPSGLPG
SPGVPGPKGEQGLSGQPGIQGKRGHGGAQGDQGPRGEPGLKGQPGEHGVQGLTGFQGFPG
PRGPEGDAGIIGISGPKGPVGQRGNTGPFGKEGIIGPTGRTGPRGEKGFRGETKQMDINA
AIQALIESHAALQMEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKYWIDPNLGCPSDAIEVFCNFSAGGQTCLSPVSVTKLEFGVGKVQMNF
LHLLSSEATHIITIHCLNTPVWTSAQSSGSGLPIGFKGWNGQIFEENTLLEPKVLSDDCK
IQDGSWHKAKFLFHTQDPNQLPVIEVQKLPHLKTERKYYIESSSVCFL
Download sequence
Identical sequences 9685.ENSFCAP00000012287 ENSFCAP00000012287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]