SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012375 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSFCAP00000012375
Domain Number - Region: 547-616
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00139
Family Spermadhesin, CUB domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012375   Gene: ENSFCAG00000013345   Transcript: ENSFCAT00000013349
Sequence length 824
Comment pep:novel genescaffold:CAT:GeneScaffold_431:90696:146526:-1 gene:ENSFCAG00000013345 transcript:ENSFCAT00000013349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGQTRGATIALLGVLLLCAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKIYVVDLSNEQAMSLTIEPRPVKFS
RRFVPGCFVCLESRTCSTNLTLTSGSKHKISFLCDDLSRLWVNAEKTISCMDHRYCPRRP
YSLQVPRDILQLPVQLHDFSWKLLVPKDRLSLALVPAQKLQQHTPEKVCNTSYSYLVAST
VPGQDLYFGSFCPGGSIQQIQVKQNVSVTLRTFAPSFQQEASRQGLTVSFIPYFKEEGVF
TVTPDTKSKVYLRSPNWDRGLPSLTSVSWNISVPSGQVACLTFLKERTGVVCQTGRAFMI
IQEQRTKAEEIFSLEDEVLPKPSFHHHSFWVNISNCSPVSGKQLDLFFWVLLTPRTMDLT
VIITAIVGGGALLLFALGLIICFVRKKKKKTSKGPSVGIYNGNINTQMPMQPKKFQKGRK
DSDSHVYAVIDDTMVYGHLLQDSNGSFLQPEVDTYRPFQGPTGDCPPSPPLTGSRAPTAK
LTVDEPSPSFPAESESEPYTFSHPNNGNTDIPLLDTHEPTEPGE
Download sequence
Identical sequences ENSFCAP00000012375 9685.ENSFCAP00000012375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]