SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012571 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012571
Domain Number 1 Region: 132-180
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000575
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 550-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000628
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 949-994
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 4 Region: 1083-1131
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 1280-1335
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000111
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number 6 Region: 616-684
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000122
Family TSP-1 type 1 repeat 0.006
Further Details:      
 
Domain Number 7 Region: 1135-1183
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000419
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012571
Domain Number - Region: 55-127
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00102
Family TSP-1 type 1 repeat 0.014
Further Details:      
 
Domain Number - Region: 819-873
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0017
Family TSP-1 type 1 repeat 0.0089
Further Details:      
 
Domain Number - Region: 354-432
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00445
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number - Region: 1-47
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.011
Family TSP-1 type 1 repeat 0.0062
Further Details:      
 
Domain Number - Region: 433-495
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.011
Family TSP-1 type 1 repeat 0.011
Further Details:      
 
Domain Number - Region: 1008-1053
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0536
Family TSP-1 type 1 repeat 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012571   Gene: ENSFCAG00000013556   Transcript: ENSFCAT00000013560
Sequence length 1516
Comment pep:novel genescaffold:CAT:GeneScaffold_2560:28045:599453:1 gene:ENSFCAG00000013556 transcript:ENSFCAT00000013560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWGRCAGDCGPGGVQSRALWCFHLEGWTSHVSNCDENSRPPKERSCFRVCDWHSDLFQWE
VSDWHHCVLAPSSLGQAEPRPEECVTAQHGLQHRTARCIQKLNRTVAGNEICEHFVPRPP
TEQACLIPCPRDCVVSEFSQWSECSKGCEKRLQHRTRAAIAPPLYGGSQCPNLTESRACD
TPVSCPLGEEEYTFSLKVGPWSKCRLPHLKEINLSGRTVLDVSSDSKERVTFRHQSYKPH
HHAKPWDLEIGYQTRQVWCTRSDGKNAMLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSWRTSE
WKECQVSLLLEQQDPYWHVTGPVCGGGIQTREVYCAQSTPASTAQRAKEVSRPVKKTLCL
GPAPPASQLCNIPCSTNCIVSSWSAWGLCIHENCHDPQGRKGFRMRQRHVLMESTGPAGH
CPHLVESVPCEDPMCYRWLMSEGVCIPHHGKCGRGHRILKAVCQNDRGEDVSGSLCPASP
PPERTACEIPCRMDCVVSEWTEWSSCSQSCSNKNADGKQTRSRIILALPGEGGKPCLTQA
LQEYRSCNDHSCMQLYWETSPWGPCSEDTLVTALNATIGWNGEATCGVGIQTRRVFCVKS
HVGQVMTKRCPDSTRPETVRPCLLPCKKDCTVTAFSEWTPCPRSCQPXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWKPQKWSPCILVPESVMHGIMGTSEACGK
GIQTXXXXXXXXXXXXXXXXXXLKQTNGMPPFVQECTVPCRDDCTFTVWSKFTPCSTDCE
TTRSRRRQLTGKSRKKEKCQDSDLYPLVEMELCPCNVFISQPYGNWSDCIIPEGRIESQR
GGFRVQGESKECGKGMRFRAIAXXXXXXXXXXXXXXXXXXYIQEECVIPCPFDCKLSDWS
SWGSCSSSCGIGVRIRSKWLKEKPYNGGRPCPKLDLKNQXXXVHEAVPCYSECNQYSWVV
EHWSPCKIHNELRSLRCGGGTQSRKIXXXXXXXXXXXXXXXXXXXXXXXXPETQSCSLLC
PSECVMSEWGPWSKCPQSCDPHSTQRRTRHLLRPSLNSRSCAEDSQVRPCLLNENCFQFQ
YNLTEWSTCQLNENATCGQGIRTRLLSCVRSDGKPVGMDQCEQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXRMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXDCHLAEWSEWSTCELTCINGRSFETMGRQSRSRTFIVQSFE
NQDSCPQQVLETRPCTGGKCYHYTWKASLWNNNERTVWCQRSDGINVTGGCSPQARPAAI
RQCNPACRKPFSYCTQGGVCGCEKGYTEIMRSNGFLDYCMKVPGSEDKKADVKNLAGKNR
PVNSKIHDIFKGWSLQPLDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKKPKPHQSTP
PQQKPLTLAYDGDLDM
Download sequence
Identical sequences ENSFCAP00000012571 9685.ENSFCAP00000012571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]