SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012574 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012574
Domain Number 1 Region: 1618-1731
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-33
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 3400-3504
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-33
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 3 Region: 2225-2333
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-33
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 4 Region: 1736-1846
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-33
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 5 Region: 2333-2445
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-32
Family Spermadhesin, CUB domain 0.00034
Further Details:      
 
Domain Number 6 Region: 1512-1618
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.28e-31
Family Spermadhesin, CUB domain 0.00099
Further Details:      
 
Domain Number 7 Region: 3034-3146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-31
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 8 Region: 3152-3266
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-30
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 9 Region: 1987-2087
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.8e-28
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 10 Region: 2089-2210
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-27
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 11 Region: 474-585
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-25
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 12 Region: 3508-3617
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-24
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 13 Region: 2913-3032
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-23
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 14 Region: 2803-2915
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.9e-21
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 15 Region: 1388-1448
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-20
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 16 Region: 3275-3388
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-18
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 17 Region: 2449-2509
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-16
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 18 Region: 2693-2737
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000536
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 19 Region: 132-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000155
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 20 Region: 1224-1275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000288
Family Spermadhesin, CUB domain 0.005
Further Details:      
 
Domain Number 21 Region: 262-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family EGF-type module 0.012
Further Details:      
 
Domain Number 22 Region: 1338-1385
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000942
Family Spermadhesin, CUB domain 0.0049
Further Details:      
 
Domain Number 23 Region: 1002-1042
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000101
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000012574
Domain Number - Region: 303-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 649-686
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0196
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012574   Gene: ENSFCAG00000013560   Transcript: ENSFCAT00000013564
Sequence length 3622
Comment pep:novel genescaffold:CAT:GeneScaffold_3528:598976:1009725:-1 gene:ENSFCAG00000013560 transcript:ENSFCAT00000013564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRNMSSPFLWSLVILVTFAESNGEVGELVLQRQKRNTDLQQPRMAAEKGNLVFLTGSAQN
IEFRTGSLGKIKLNDEDLGQCLHQIQKNKDDITSLKRSAVSLPQNISSQIHQLNSKLADL
ERKFQSLQQMVDKNVCSSNPCQNGGTCLNLHNSFVCICTSQWEGPLCSVDVNECEIYSET
PLGCQNGSTCINTAGSYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PMYSCICDAGWTSPPNSSACLLDIDECSLQPAPCSTLAQCFNTPGSFYCGACPTGWQGNG
YSCQDINECDINNGGCSMVPPVTCVNTFGSYHCQAXXXXYQGNGRVCTLVNVCLVDNGGC
HPHASCSSILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGGSLSG
MNGSFSYKSPDVGYVHDVNCFWVIRTEEGKVLRITFTFFQLESVNNCPHEFLQVHDGDSS
AAFQLGRFCGSVPPHELLSSDNALYFHLYSEHLRNERGFTIRWETQQPXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRDGPLYHDPV
LGKFCTTFSVPPLQTTGPFARIHFXXXXXXXXXXXXXXXXXXXXDLHCGXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYCGKSVPPSLTSSTNAL
MLAFVADSDLAYEGFLINYEAIDVSAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXVYDGSSTSSHLLSQLCGDETPPLIRSSGDSMFLKLR
TDEGQQGGGFLAKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXLYDGPQRMGRYCGADLPPAGSTTGSRLQVLFHTDGVGHHERGF
QMQWFIHGCGGELSGTTGTFSSPGYPNTYPPNKECIWYINTAPGSSIQLTIHDFDVEYHS
RCNFDVLEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXCGGIFQAPNGEIHSPNYPSPYRSNTDCSWVIRVERNHRVLLNFTDFDLEPQDS
CIMAYDGVSPTTARLARTCGRQPLANPIVSSGNSLLLRFQSGPSRQSRGFRAHFSQACGG
YILTDSSDTISSPLFPAKYPHNQNCSWIIQAQPPFNHITLSFSHFGLESTAMCTQDFLEI
LDGSYDDAPLRGRYCGASMPHPITSFSNALTLRFVSDARVNSEGFHATYAASSSACGGTF
HMAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDCNRDFVEIREGN
ATGTLVGRYCGNVLPLNYSSIVGHILWIRFVSDGSGSGIGFQATFTNXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLEIDIEATQNCYYDKLRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSSISRERFLLEWFAMKVSVGPSPTIAPGAWGGFL
RTGDAPAFLFSPGWPESYSNSAECMWLIQAPDSTVELNILSLDIEAHRTCDYDKLVIRDG
DNNQAQQLAVLCGREIPGPIRSTGEYMFIRFTSDFSVTRPGFNASFHKGCGGYLHADRGI
ITSPQYPETYGPNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCSQGDYLALKNGPDIY
SPPLGSHGGNGRFCGSRPSSTLFTSDNRMFVQFISDGSNGGQGFKIKYEAKSLACGGNIY
IHDADSAGYVTSPNHPDNYPQHADCTWLIAAPPGKLIRLQFEDQFHIEETPSCTSNYLEL
RDGADSNARVLSKVCGTSLPNSQLSSGEVMYLRFRSDNSPTHVGFKIKYAIAPCGGRVTG
QSGVIESSGYPTLPYRDNLLCEWHLEGPSGHYLTIHFEDFNLQNSSGCEKDFVEIWENHI
SGNLLGRYCGNTIPDSIDTSSNIALVRFVTDGSLTASGFRLRFESSMEECGGDLQGPTGT
FTSPNFPNPNPHSRLCEWRITVQEGRRITLTFNNLRLQVHPSCNSERVTXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGESGVITS
PNYPASYDSSTHCSWLLEAPQGHTITLTFSDFDIEAHATXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGGVLHSDNGTIRSPHWP
QNFPQNSRCSWTVITHESKQLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEMDKALLASS
CGSVAPASIMTPRNAFTAVFQSQEAPAQGFSASFVSRCGGNFTNPSGYILSPNYPKHYDN
DMNCTYIIKADPLSLVLLTFVSFHLEARSVVTGSCDSDGLHIIRGSSFSSTPFATICGDE
ILPPVTIVGPVLFNFYSNAYTTALGFKLDYKITPCGGVFNFSIGVIRSPAYAHSDYPNNI
HCLYTIIGREDRVIQLKFSDFDVVPSTFCSQDYLAIYDGSNTSNPLLGKFCGSILPPNIK
SNNNSMLLVFKTDSFQTARGWKITFHQTLGPQQGCGGYLTGSSDTFASPDSDSNGRYDKN
LNCVWFIVAPVNNVIQLTFATQGREASSSAQRCIYDYVKLYDGDSENANLAGMFCGSTVP
APFISSGNFLTVQFVSDLTVERQGFXXXXXXXXXPCGGTYNATWTPQSISSPNSSDPEIP
FSTCTWVLEAPPHQQVKITVWALQLHPQDCDQNYLEFQDSPERDGNPGIHFCGRNASAVP
MFYSSASTAIVVFKSEVLDRNSRVGFTYQIAGCNREYNRAFGNLKSPGWPDNYNNNMDCT
VTLTAPQNHTISLFFHSFGIEDSSECMHDFLEVRNGSDSSSPLLGTYCGTLQPNPIFSQN
NELYLRFKSDGATSGLGYEIVWTSSPSGCGGTLYGHSGSFTSPGYPGTYPNNTHCEWTII
APAGRPVTVSFYFVSIDDPGDCVQNYLILYNGPDANSPTSGPNXXXXDTNIAPFVASSHR
VFVKFHAEYALRPSAIRLTWDS
Download sequence
Identical sequences 9685.ENSFCAP00000012574 ENSFCAP00000012574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]