SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012906 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012906
Domain Number 1 Region: 165-246
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.6e-24
Family Eukaryotic proteases 0.0056
Further Details:      
 
Domain Number 2 Region: 317-414
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.89e-21
Family Eukaryotic proteases 0.014
Further Details:      
 
Domain Number 3 Region: 34-80
Classification Level Classification E-value
Superfamily SEA domain 0.000000471
Family SEA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012906   Gene: ENSFCAG00000013916   Transcript: ENSFCAT00000013920
Sequence length 415
Comment pep:novel genescaffold:CAT:GeneScaffold_2956:5318:158189:-1 gene:ENSFCAG00000013916 transcript:ENSFCAT00000013920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PARVPSASRFLNPYVVGFVVVAGVVILAVTTALLIHFLAFAKTPFYYHISFKVNNIDYDS
KFEKPYSQEYMDLNKKIVSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXITDQDTVDMFTQGCGARTDLITLS
AERILGGTKAEEGDWPWQVSLQTNNVHHCGGILISSLWILTAAHCFRSYPNPRQWTVTFG
VSTTFPKQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSTVSDLQQARVRIISNDAXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGDSGGPLVQEDSRRLWFLVGIVSWGDQCGLPDKPGVYTRVTAYRAWITEKTGV
Download sequence
Identical sequences ENSFCAP00000012906 9685.ENSFCAP00000012906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]