SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012913 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012913
Domain Number 1 Region: 216-358
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.5e-31
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00038
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-25
Family Spermadhesin, CUB domain 0.00065
Further Details:      
 
Domain Number 3 Region: 157-213
Classification Level Classification E-value
Superfamily LCCL domain 0.000000000000745
Family LCCL domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012913   Gene: ENSFCAG00000013925   Transcript: ENSFCAT00000013929
Sequence length 497
Comment pep:novel genescaffold:CAT:GeneScaffold_2966:3878:163338:1 gene:ENSFCAG00000013925 transcript:ENSFCAT00000013929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGCGHIVTYQDSGTMTSKNYPGTYPNHTVCEKTIRVPKGKRLILRLGDLDIESQTCASDY
LLFTTNSDQYGPYCGSMSVPKELLLNTNEVTIRFESGSHISGRGFLLTYASSDHPDLITC
LERANHYLKPEYXXXXXXXXXXXXXXXXXXXXXXXXXTSVLCKAAIHAGIIADELGGQIS
VLQLKGISRYEGILANGVLSKDGSLSDKRFLFTSDGCSRSLSLEPDTQIRTTWQWVSEMG
EQLHWSPGQAQLQDQDLSWASGDSSKNRKQREWLETDLGEKKKITGIMTTGSTQSNFNFY
VKSFVMKFKNSNSKWRTYKGIANNKEKVFQGNSNFRDPVRNNFIPPIVARYVRVVPXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINVTTVV
IPLVLLALLVAGMGIFAALRKRKKKGNPYGSAQAQKTDCWKQIKYPFARHQSAEFTISYD
NEKEVTQKLDLITSDMA
Download sequence
Identical sequences ENSFCAP00000012913 9685.ENSFCAP00000012913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]