SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013032 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013032
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.6e-48
Family Eukaryotic proteases 0.000000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013032   Gene: ENSFCAG00000014052   Transcript: ENSFCAT00000014057
Sequence length 194
Comment pep:novel scaffold:CAT:scaffold_100711:83363:86195:1 gene:ENSFCAG00000014052 transcript:ENSFCAT00000014057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHKGQLFKVILGAYFLSKNEASKQMFDIKKFIPFSRLTSYRKSNDIMLIQLHTAATLNQH
VQLLHPSSKNDIRAGTKCQVTGWGATDPEFLRISDTLREVTVTVISRKLCNSPSYYNHSP
VITKGMICAGDDRGHKDSCQGDSGGPLVCKGAFHALVSGGHQCGHPKKPGIYTLITQKYQ
AWIKSKLAPSHANY
Download sequence
Identical sequences ENSFCAP00000013032 9685.ENSFCAP00000013032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]