SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013134 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013134
Domain Number 1 Region: 500-610
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 141-258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000114
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 319-432
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000131
Family Spermadhesin, CUB domain 0.0047
Further Details:      
 
Domain Number 4 Region: 616-674
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000144
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 676-737
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 744-810
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000288
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 437-502
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000485
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013134   Gene: ENSFCAG00000014159   Transcript: ENSFCAT00000014163
Sequence length 883
Comment pep:novel genescaffold:CAT:GeneScaffold_3995:95213:115112:-1 gene:ENSFCAG00000014159 transcript:ENSFCAT00000014163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPLKEEEVLPELGSEAPTVASEALAELLHGALLRRGPEMGYLPGSDPDPTLATPPAGQTL
AAPSLPRATEPGTGPLTTAVTPKGGRGAGPTAPELLTPPPGTTAPPLPGPASPGPPLGPE
GGEEETTTTIITTTTVTTTVTSPVLCNNNISEGEGHVESPDLGSAASRTLGLLDCTYSIH
VYPGYGIEIQVQTLNLSREEELLVLAGGGSPGLAPRLLANSSMLGEGQVLRSPTNRLLLH
FQSPRVPRGGGFRIHYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXSCGGTIHNATLGRIVSPEPGGAAGPNLTCRWVIEAAEGRR
LHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDSDMDDVPERGLISDAQSLYVELLSETPA
NPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPEYRPGALATFSCLPGYALEPPGPPNAIE
CVDPTEPHWNDTEPACKAMCGGELSEAAGVVLSPDWPQSYSPGQDCVWGLHVQEEKRILL
QVEILNVREGDMLTLFDGDGPSARVLAQLRGPQPRRRLLSSGPDLTLQFQAPPGPPNPGL
GQGFVLHFKEVPRNDTCPELPPPEWGWRTASHGDLIRGTVLTYQCEPGYELLGSDILTCQ
WDLSWSAAPPACQKIMTCADPGEITNGHRTTSDAGFPVGSHVQYRCLPGYSLEGAAVLTC
YSRDTGTPKWSDRVPKCALKYEPCLNPGVPENGYQTLYKHHYQAGESLRFFCYEGFELIG
EVTITCVPGHPSQWTSQPPLCKVTQTTDPSRQLEGGNLALAILLPLGLVIVLGSGVYIYY
TKLQGKSLFGFSGSHSYSPITVESDFSNPLYEAGDTREYEVSI
Download sequence
Identical sequences ENSFCAP00000013134 9685.ENSFCAP00000013134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]