SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013217 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013217
Domain Number 1 Region: 296-467
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.85e-56
Family Eukaryotic proteases 0.000000491
Further Details:      
 
Domain Number 2 Region: 40-103
Classification Level Classification E-value
Superfamily GLA-domain 3.73e-25
Family GLA-domain 0.00011
Further Details:      
 
Domain Number 3 Region: 128-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000104
Family EGF-type module 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013217   Gene: ENSFCAG00000014244   Transcript: ENSFCAT00000014248
Sequence length 478
Comment pep:novel genescaffold:CAT:GeneScaffold_4822:324169:335053:1 gene:ENSFCAG00000014244 transcript:ENSFCAT00000014248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRCLVLLSASLTCLLLLGDSVFLPTEHASSVLGRVRRANSFWEEMKKGNLERECMEE
TCSFEEAREVFEDTAKTTEFWNKYKDGDQCESNPCQNQGKCMDSLGGYTCTCLEGYEGKN
CELSMRKACSLDNGDCDQFCSEEQGSVVCACASGYVLADDGKSCVSTGPFPCGKRTLTRR
KRSAETAHGGEGPSDSRWQDQHPEDLPPTDSPLYLQPLNKTEASPVEDSSNLIRIVGGQN
CPDGECPWQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXERDTGSEEGDE
VAHEVDVIIKHNKFVRETYDFDIAVIRLRTPITFRRNVAPACLPQKDWAESTLMAQKTGI
VSGFGKTHEKGRPSTILKMLEVPYVDRNTCKLSSSFTITQNMFCAGYDTNPEDACQGDSG
GPHVTRFKDTYFVTGIVSWGEGCARKGKYGVYTKVTNFLKWIDKSMRARAGPKAESLA
Download sequence
Identical sequences ENSFCAP00000013217 9685.ENSFCAP00000013217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]