SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013373 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013373
Domain Number 1 Region: 298-481
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-38
Family SPRY domain 0.00023
Further Details:      
 
Domain Number 2 Region: 14-85
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-20
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 94-145
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000214
Family B-box zinc-binding domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013373   Gene: ENSFCAG00000014419   Transcript: ENSFCAT00000014423
Sequence length 491
Comment pep:novel genescaffold:CAT:GeneScaffold_113:70801:115389:-1 gene:ENSFCAG00000014419 transcript:ENSFCAT00000014423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELGPAVSPGPSRSFKEELLCAVCYDPFRDAVTLRCGHNFCRGCVTRCWEVQVTPTCPVC
KDRAALADLRTNHTLNNLVEKLLREESEGARWAGHRSARLCRLHRGQFSIFCLDDKELGF
CSCQTDSRHQRHRVQPEKDTTHNFRVWSLTASEREGLPTRQWLVTKTLFIRSPNFQSRSQ
CQVQEHGACAAGESQGLLGCAALLDAMAEEAREKQRLAEGKMKRLAEDTEALAHEIERLQ
VEMKEDDVSFLMKHKSRKRRLFCTMEPEPVQPGMLIDVCKYLDSLQYRVWRKMVTSVESV
PFSFDPNTAAGWLSVSNDLTSVTNHGYRVQVENPERFSSAPCLLGSRVFSQGSHTWEVDL
GGLPSWRVGVMRLQQDTGAEGHSHSCYHDTRSGFWYVCRTQGVEGDHCVTSDPATSALVP
AIPHRLRVELECEEGELSFYDAESHCHLYTFHARFGEVRPYFYLGGMRGDGPAEPLRICP
LRITVKEELDG
Download sequence
Identical sequences ENSFCAP00000013373 9685.ENSFCAP00000013373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]