SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013628 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013628
Domain Number 1 Region: 61-244
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-76
Family Calnexin/calreticulin 0.00000000704
Further Details:      
 
Domain Number 2 Region: 344-397
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 2.35e-23
Family P-domain of calnexin/calreticulin 0.0000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013628   Gene: ENSFCAG00000014692   Transcript: ENSFCAT00000014695
Sequence length 592
Comment pep:novel genescaffold:CAT:GeneScaffold_2668:1063:16216:1 gene:ENSFCAG00000014692 transcript:ENSFCAT00000014695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGKWLLCMLLVLGTTIVHAHEGHDDDMIDIEDDLDDVIEEVEDSKSKPDTSAPPSPKVT
YKAPVPTGEVYFADSFDRGTLSGWILSKAKKEDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDEDMDGEWEAPQIANPK
CESAPGCGLWQRPMIDNPNYKGKWKPPMIDNPNYQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDNFIICGDRRVVDDWANDGCGLKKAADAVEPGVVGQMIEAAEER
PWLWVVYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEDEILNRSPRNRKPRRE
Download sequence
Identical sequences ENSFCAP00000013628 9685.ENSFCAP00000013628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]