SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013840 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013840
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-17
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 213-327
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000314
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 416-453
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000458
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 126-163
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 172-211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000113
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 377-414
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000013840
Domain Number - Region: 328-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00147
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013840   Gene: ENSFCAG00000014920   Transcript: ENSFCAT00000014924
Sequence length 732
Comment pep:novel genescaffold:CAT:GeneScaffold_3955:613358:618744:1 gene:ENSFCAG00000014920 transcript:ENSFCAT00000014924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACSGKLEQHTERRGVIYSPAWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSL
DWLIRGTAAPPHKEARLCGAAIQPVQITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XKLGQASCQADEFRCDNGKCLPGPWQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFP
CSGARSTRCLPAERRCDGTQDCGDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPS
DLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEA
AQGRLTVAYHARARSAGHGFNATYQVKGYCLPWEQPCGSSSEGAAGDAGEQGCFSEPQRC
DGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPG
TFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGC
AFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASV
LQNLRTAMRRQMQHASRRGPSRRRLGRLWNRLFXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXAGPGERPPDGVGRAGEDGSAVLTPSGLQDPQGLRDK
ERQACTDSLVDSLAPAKTPVEDCSALDPHPLVPTAISTLGPLPGLPLGVCRSPPPPCSPT
LEASDKKTLLVC
Download sequence
Identical sequences 9685.ENSFCAP00000013840 ENSFCAP00000013840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]