SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014043 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014043
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000057
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014043   Gene: ENSFCAG00000015139   Transcript: ENSFCAT00000015143
Sequence length 217
Comment pep:novel genescaffold:CAT:GeneScaffold_1770:73987:79284:1 gene:ENSFCAG00000015139 transcript:ENSFCAT00000015143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCTRVQPPPRGTLQVLRGDGTSVGTVLVFHCPSGHQMVGSGLLTCAWKGSIAEWSSVSPV
CKSVPPYETFGFKVAVIASIVSCAVILLMSVAFLTCCLMRCMKRSERPSDRATQLWLQLR
AGDLDTVQASYLGLKGPNNPGVRPGQAHDNYSFTTDLGEGTREMAGMARGVDKDPWTTSS
GSPRAQVMVHTADPGHALPASWPAAGMSRQHAAYVPG
Download sequence
Identical sequences 9685.ENSFCAP00000014043 ENSFCAP00000014043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]