SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014136 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014136
Domain Number 1 Region: 806-914
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 317-437
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-16
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 279-323
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000117
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 115-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000046
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 82-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 6 Region: 171-316
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000022
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 685-802
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000628
Family Growth factor receptor domain 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000014136
Domain Number - Region: 619-668
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00581
Family Growth factor receptor domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014136   Gene: ENSFCAG00000015237   Transcript: ENSFCAT00000015244
Sequence length 992
Comment pep:novel genescaffold:CAT:GeneScaffold_4001:142529:346511:-1 gene:ENSFCAG00000015237 transcript:ENSFCAT00000015244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLGRGCPGTAGALLPLLLPLLLTAAVPPGRSRAPGPPEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIDECENEFNGGCVHDCLNIPGNYRCTCFDGFMLAHDGH
NCLDVDECLENNGGCQHTCVNVMGSYECRCKEGFFLSDNQHTCIHRSEEGLSCMNQNHGC
GHICKEAPKGSVACECRPGFELAKNQRDCILCNHGNGGCQHCEDTEGPECSCHPGYKMHT
DGRSCLEQEDAALEVTESNATSVVDSDKRVKRRLLMETCAVNNGGCDRTCKDTSTGVHCS
CPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVGSFDCSCRKGFKLLTDEKSCQDVDE
CSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSVNNGGCQQVCVNTVGSYEC
RCHSAYKLHWNKKDCVEVKGVLPTSVSPHVSLHCGRSGGGDRCFLRCHSGIHLSSXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSCDLSCIVKRTEKRLRKAIRALRKAAHREQFHLQLSG
MDLEVAKKSPRTSEHRVESCGVGQGHAGHQCVSCRAGTYYDGAQERCILCPNGTFQNEEG
QITCEPCPRPENPGVLKTPEAWNISECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTS
CFPCGGGLPTKHLGATSFQDCETRVQCSPGHFYNTTTHRCIRCPAGTYQPEFGKNNCVSC
PGNTTTDFDGSTNITQCKDRRCGGELGDFTGYIESPNYPGNYPANTECTWTINPPPKRRI
LIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLWIQFKSNE
GNSARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDVLAHPQNY
FKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences 9685.ENSFCAP00000014136 ENSFCAP00000014136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]