SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014176 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014176
Domain Number 1 Region: 229-393
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.88e-30
Family Reprolysin-like 0.007
Further Details:      
 
Domain Number 2 Region: 542-592
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 3 Region: 972-1028
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 4 Region: 802-861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 5 Region: 932-967
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000667
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014176   Gene: ENSFCAG00000015286   Transcript: ENSFCAT00000015290
Sequence length 1098
Comment pep:novel genescaffold:CAT:GeneScaffold_328:190027:573819:-1 gene:ENSFCAG00000015286 transcript:ENSFCAT00000015290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCDGALLPPLVLPLLLLLFWGLDPGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGLIQLGQEQVLIQPLNSSRGPLSGREHLV
RRKWSLTPSPSTEAPIPGQLCKVLTEKKKPRRGRPSQDWRERRNAIQLTSEHTVETLVVA
DADMVQYHGAEAAQRFILTVMNMVYNMFQHQSLGSKVNIQVTKLVLLRQRPAKLSIGHHG
ERSLESFCHWQNEEYGGARYLGNNQVPGGKDDTPPVDAAVFVTRTDFCVHKDEPCDTVGI
AYLGGVCSAKRKCVLAEDNGLNLAFTIAHELGHXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSKVSTCLLDTDPRSQHAVRLXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPE
HVDGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCLGASVEHAVCENLPCPKG
LPSFRDQQCQTHDRLSSKKKGLLTAVVVDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKIGCDGIIGSAAKEDRCGVCSGDGKTCRVVKGDFSHSRGTALKDTSKR
SINSDWKIELPGEYQIAGTTVRYVRRGLWEKISAKGPTKIPLHLMVLLFHDQNYGIHYEY
TVPVNYTAENQSEPEKPQDSLFIWTHSGWEGCSVQCGGGERRTIVSCTRIVNKTTTLVND
SDCPQASRPEPQVRRCNSHPCQSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCSATCGKGTQKRTVTCTNSQGKCDASMR
PKAEEACEDYSGCYEWKTGDWSKCSSTCGKGLQSRVVQCMHKVTGRHGNECPALSKPAAY
RQCHQEVCNDKINVNTITSPRLAALTYKCTRDQWTVYCRVIREKNLCQDMRWYQRCCQTC
RDFYANKMRQPLPPPPSS
Download sequence
Identical sequences 9685.ENSFCAP00000014176 ENSFCAP00000014176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]