SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014190 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014190
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily Cupredoxins 1.46e-46
Family Ephrin ectodomain 0.000000325
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014190   Gene: ENSFCAG00000015301   Transcript: ENSFCAT00000015305
Sequence length 292
Comment pep:novel genescaffold:CAT:GeneScaffold_1716:171421:200327:-1 gene:ENSFCAG00000015301 transcript:ENSFCAT00000015305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKEQADRCTIKKENTPLLNC
ARPDQDVKFTIKFQEFSPNLWGLEFQKNRDYYIISTSNGSLEGLDNQEGGVCQTRAMKIL
MKVGQDASSAGSTRHNDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGSSAGHSGNNIL
GSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTATLSLSTLATPKRSGNN
SGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Download sequence
Identical sequences ENSFCAP00000014190 9685.ENSFCAP00000014190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]