SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014243 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014243
Domain Number 1 Region: 8-260
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-79
Family Eukaryotic proteases 0.000000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014243   Gene: ENSFCAG00000015359   Transcript: ENSFCAT00000015363
Sequence length 263
Comment pep:novel genescaffold:CAT:GeneScaffold_3696:471:5124:-1 gene:ENSFCAG00000015359 transcript:ENSFCAT00000015363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLWLLSCFALVGAAFECGVPAIEPVLNGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSHVVVAGEFDQHANEENIQVLKIAKVFKNPKFNMLTVRND
ITLLKLATPARFSETVSPVCLPAATDEFPPGLLCATTGWGKTKHNANKTPDKLQQAALPL
LSNADCKKFWGSKXXXXXXXXXXXXXXXCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCST
SVPAVYARVTKLIPWVQEILAAN
Download sequence
Identical sequences ENSFCAP00000014243 9685.ENSFCAP00000014243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]