SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014244 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014244
Domain Number 1 Region: 104-259
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.07e-54
Family Eukaryotic proteases 0.00000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014244   Gene: ENSFCAG00000015360   Transcript: ENSFCAT00000015364
Sequence length 261
Comment pep:novel genescaffold:CAT:GeneScaffold_3696:21846:26283:1 gene:ENSFCAG00000015360 transcript:ENSFCAT00000015364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLWLLSCCALLGTAFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFKNPKFNMFTINND
ITLLKLATPARLSQTVSPVCLPNAKDSFPAGTLCATTGWGLTKHTKTPDRLQQAALPLLS
NTKCQKFWGSKITNLMVCAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCSTSM
PGVYARVTKLMPWVQQILEAN
Download sequence
Identical sequences ENSFCAP00000014244 9685.ENSFCAP00000014244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]