SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015385 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015385
Domain Number 1 Region: 131-218
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.8e-25
Family Eukaryotic proteases 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015385   Gene: ENSFCAG00000018533   Transcript: ENSFCAT00000018238
Sequence length 219
Comment pep:novel genescaffold:CAT:GeneScaffold_1652:172075:180292:1 gene:ENSFCAG00000018533 transcript:ENSFCAT00000018238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRLLSAALLFVGSALPYAAHYSLSERTGRGPWQEQVAAPGWPEARERRRAPQAREEGA
AGEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDPLMWRVVIGTNNIHGGPPYSKKIKVKAIIIHPDFNLETYVNDIALFHLK
KAVRYNDYIQPICLPFDVFQMLDQNTKCFISGWGRTKEE
Download sequence
Identical sequences 9685.ENSFCAP00000015385 ENSFCAP00000015385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]