SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015690 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015690
Domain Number 1 Region: 475-536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000038
Family Complement control module/SCR domain 0.0054
Further Details:      
 
Domain Number 2 Region: 355-410
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000027
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 44-107
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000709
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000015690
Domain Number - Region: 167-218
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000445
Family Complement control module/SCR domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015690   Gene: ENSFCAG00000018927   Transcript: ENSFCAT00000018215
Sequence length 537
Comment pep:novel genescaffold:CAT:GeneScaffold_2061:493:93723:1 gene:ENSFCAG00000018927 transcript:ENSFCAT00000018215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKADLEYHHCRTVSKYMRLGPSMLLLINAILILWISTVEGQVGHCDFPRINHGILYGDKK
DPPFSSVPVGKTFYYSCEYSFVSPSKSFWNRITCREEGWSPTPRCLXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIECLVPFLEANVHV
YPKQEKYTPGDVLQFSCGRGLVRGWEPDSVQCHFWDGSPNFPTWXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSICIXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKETQLCPPP
PQIPNAQNMLTTVNYQDGEKVAILCKENYLLHGAREIVCKSGKWQSLPQCIXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXACIISED
NMNKYNVQLRGKDTKKLYVKTGDFVEFECKWPHKANTSIQSFRAICQEGEVEYPRCE
Download sequence
Identical sequences 9685.ENSFCAP00000015690 ENSFCAP00000015690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]