SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015865 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015865
Domain Number 1 Region: 6-244
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.06e-63
Family Eukaryotic proteases 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015865   Gene: ENSFCAG00000018068   Transcript: ENSFCAT00000018386
Sequence length 294
Comment pep:novel scaffold:CAT:scaffold_200776:47928:54124:-1 gene:ENSFCAG00000018068 transcript:ENSFCAT00000018386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDRGVSTVCGRPKVTGKIYGGQDVLAGQWPWQASLLYQHTHICGAVLIDSLWLVSTAHCF
LNKSQAPADYQVLLGSTRLYQHGQHTREMSVSRIIVHPDFEKLHPFGSDITMLQLHVPVN
FTSYIAPACLPSPGMQLSSNLSCWITGWGMLSEDRELPFSSSESPRDDGFRSVIVLGQIS
TCVHSSMLVWISTRGGDSGGPLVCNLLSAWVLVGLASWGLDCRHPIYPSVFTRVDYFTDW
IDKIQRFTPPPDPMSAPQTQFPDQPWQTAGSSGHSTTLMSPQTWSLLLFMLRGP
Download sequence
Identical sequences ENSFCAP00000015865 9685.ENSFCAP00000015865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]