SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015877 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015877
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily SEA domain 5.89e-19
Family SEA domain 0.01
Further Details:      
 
Domain Number 2 Region: 252-322
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000000000000548
Family Eukaryotic proteases 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015877   Gene: ENSFCAG00000018208   Transcript: ENSFCAT00000018907
Sequence length 323
Comment pep:novel genescaffold:CAT:GeneScaffold_4451:31574:47044:-1 gene:ENSFCAG00000018208 transcript:ENSFCAT00000018907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NIFYYQGDFHISGVTHNDSCENGASQASTDLNKNIETKMSDVFQNSSIYKEYINSVIKLL
PDPNGSRVQLQLTFKFPPAKRHSMKTEIEAILHQILKNNMVSWNAVHTSFRLIXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEVFFT
KFRRIFLQEAKMPLPAVLQEAFGKVIDNKVCNHPHSLSGLVTNKMLCAVFKSGKADACQN
DSGGLLAYPDSRKVWHLVGIVSL
Download sequence
Identical sequences ENSFCAP00000015877 9685.ENSFCAP00000015877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]