SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016137 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016137
Domain Number 1 Region: 9-270
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.42e-62
Family Eukaryotic proteases 0.00046
Further Details:      
 
Domain Number 2 Region: 293-523
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.57e-50
Family Eukaryotic proteases 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016137   Gene: ENSFCAG00000002602   Transcript: ENSFCAT00000002602
Sequence length 553
Comment pep:novel genescaffold:CAT:GeneScaffold_2805:172655:177656:-1 gene:ENSFCAG00000002602 transcript:ENSFCAT00000002602 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSWGPELLILGAVVLMEGLQAAQHVCGQRGPGPPEPQEGITAPGEWPWQASVRRQGVH
ICSGSLVADTWVLTAAHCFEKAAVTELNSWSVVLGSLQREGLSPGAEEVGVTALQLPRAY
NHYSQGSDLALLRLAHPMARTPLCLPQSTHRFPFGTSCWATGWDQDTNDAPRTLRNLRLR
LISRPTCNCLYNRLHQRLLASPARPGMLCGGAQPGVQGPCQGDSGGPVLCREPDGHWVQA
GIISFASSCAQEDTPVLLTNMAAHSSWLQARAQGAAFLSQNPETPEISDEDSCVACGSLR
RGGPQAGAPSPWPWDARLKHQGKLACGGALVSEEVVLTAAHCFIGRQTPEEWSIGLGTGP
EERGLKQLILHGAYTHPEGGYDVALLLLDQPVTLGPSLRPLCLPYADHHLPDGEHGWVLG
LPRQEAGASSPQTVPVTLLGPRACSRLHTALGSDSIPILPGMVCTSVVGEPPRCEGLSGA
PLVHEVRGTWFLAGLHSFGDACQGPARPAVFAALPAYENWVSSLDWQVYFAEEPEPEAET
GSCLANMSKPAGC
Download sequence
Identical sequences 9685.ENSFCAP00000016137 ENSFCAP00000016137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]