SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016287 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016287
Domain Number 1 Region: 69-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-20
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 2 Region: 5-65
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000162
Family Complement control module/SCR domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016287   Gene: ENSFCAG00000018427   Transcript: ENSFCAT00000019263
Sequence length 134
Comment pep:novel scaffold:CAT:scaffold_217485:49744:79332:1 gene:ENSFCAG00000018427 transcript:ENSFCAT00000019263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSHTCGNPGEILKGVLHGTRFNIGDKIRYSCLSGYILEGHAILTCIVSPGNGASWDFPA
PFCRAEGACGGTLRGTSSHISSPHFPSEYGNNADCTWTILAEPGDTIALVFTDFQLEEGY
DFLEISGTEAPSIW
Download sequence
Identical sequences 9685.ENSFCAP00000016287 ENSFCAP00000016287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]