SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000224 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000224
Domain Number 1 Region: 70-100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000312
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000224   Gene: ENSFCAG00000000243   Transcript: ENSFCAT00000000243
Sequence length 468
Comment pep:novel genescaffold:CAT:GeneScaffold_1727:2620:34879:-1 gene:ENSFCAG00000000243 transcript:ENSFCAT00000000243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRCLPLLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXIDECETGLAKCKKKSYCRNEIGSYYCSCVPNSVFNFVAGFLNDYKECYEAT
GEEIQVSRDIQEILMNNGSKNHIAKVATQVLQDMELIVWTEASAFPGKYENSTLGIVYET
KRCNDTSEKTLLEAGNNTMDINCTDAFKGTIGDRSAVALSLINLLGILPIXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVLCSIIAGVLHYLYLASFTWMLLEGLQLFLTVRNLKVA
NYIITRKFKKFMYPFGYGVLALIVAVSTGVGHSSYGIHINCWLKHDKAFIWSFMGPVAVI
ILINLVFYFQILWILRSKLSSLNKEVSTIQDTRVMTFKAIAQLFILGCSWGLGYFMVEEF
GKVIGSVIAYTFTIINVLQGVLLFVVHCLLNRQVRLIVLFITSVPPSY
Download sequence
Identical sequences 9685.ENSFCAP00000000224 ENSFCAP00000000224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]