SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000473 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000473
Domain Number 1 Region: 129-155,184-421
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.02e-68
Family Nuclear receptor ligand-binding domain 0.00000000182
Further Details:      
 
Domain Number 2 Region: 76-161
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-30
Family Nuclear receptor 0.00000936
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000473   Gene: ENSFCAG00000000509   Transcript: ENSFCAT00000000509
Sequence length 423
Comment pep:novel genescaffold:CAT:GeneScaffold_2003:59650:65008:1 gene:ENSFCAG00000000509 transcript:ENSFCAT00000000509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGHKEEEDGEGAG
PGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACKAFFKRTIQGSIEYSCPASNE
CEITKRRRKACQACRFTKCLRVGMLKEGVRLDRVRGGRQKYKRRPEVDPLPFPGSFPAGP
LAGAGGPRKTAAPVNALVSHLLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTI
SWAKSIPGFSSLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQLREALHEALL
EYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFYGVKLEGKVPMHKLFLEMLEA
MMD
Download sequence
Identical sequences ENSFCAP00000000473 9685.ENSFCAP00000000473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]