SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001365 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001365
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-38
Family SCAN domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 490-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 591-643
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.44e-19
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-17
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 5 Region: 231-292
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000288
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 
Domain Number 6 Region: 546-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000474
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 7 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000635
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001365   Gene: ENSFCAG00000001471   Transcript: ENSFCAT00000001471
Sequence length 648
Comment pep:novel scaffold:CAT:scaffold_136897:1314:6321:-1 gene:ENSFCAG00000001471 transcript:ENSFCAT00000001471 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETVHPGAEPESPNELQNAVQTSTPEESHEETTQ
SPDLGPPEEPSVCHELEFQPLQQSELPVPQGPDLPEERSPGNPEMVAFLTALSQGLVTFK
DVAVCFSQDQWSDMDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDEISHVREEEPLVPDI
PEPQEPQEPEILSFTYTGDRSEDEEEYLEQEDASLEDIHRSILGDPEIHQTPDWEIVFED
DPSRPNERSFGTNTSQVNSLSNLRETMPICPLLGRHHDCPVCGKSFTCNSHLVRHLRTHT
GEKPYKCMECGKSYTRSSHLARHQKVHKMGTAYKFPLNRKNLDETSPLVQPERTPPVEKP
FRCDDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCG
ECGEDFSDHRRYLAHRKTHAAEELYLCSECGRCFNHSAAFAKHIRGHASVRPCRCNECGK
SFSRRDHLVRHQRTHTGEKPFTCSTCGKSFSRGYHLIRHQRTHSEKTS
Download sequence
Identical sequences ENSFCAP00000001365 9685.ENSFCAP00000001365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]