SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001828 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001828
Domain Number 1 Region: 7-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000011
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 
Domain Number 2 Region: 268-366
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000112
Family V set domains (antibody variable domain-like) 0.041
Further Details:      
 
Domain Number 3 Region: 410-504
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000983
Family V set domains (antibody variable domain-like) 0.042
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000001828
Domain Number - Region: 680-789
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000376
Family V set domains (antibody variable domain-like) 0.035
Further Details:      
 
Domain Number - Region: 539-571,610-643
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00371
Family I set domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001828   Gene: ENSFCAG00000001977   Transcript: ENSFCAT00000001977
Sequence length 862
Comment pep:novel genescaffold:CAT:GeneScaffold_1441:248200:293134:1 gene:ENSFCAG00000001977 transcript:ENSFCAT00000001977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCRGRVVRVPSGSLVRVVGTELVIPCNVSDYDGPSEQNFDWSFSSSGSSFVELASTWEAG
FPAQPYRERLQRGEILLRRTANDGVELHIKNVQPSDQGHYKCSTPSTDATVQGNYEDIVQ
VKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLRVAVARNVSVAEGKGLDLTCNITTDRADDVRPEVTWYF
SRTPDGAWPGAPVLARLDRDSLVHSSPHVALSHVDARSYHLLVRDVSKENSGYYFCHVAL
WAPGHNRSWHKVAEARSAPASVDVTWLEPDYQVYLNASKVPEFSDDLTELECRIVDMKSL
QASVRFTVSWYYRVNRRSDDLVASELLAVMNGDWTLKYGDRSKQRAQDGDFIFSKERTDT
FSFRIQRTTEEDRGSYYCAVSAWTKQRNDSWVKSKDVFSKPVNIFWASEDSVLVVKARQP
KPFFAAGNTFEMTCKVSSKNIKSPRYSVLITAEKPVGDLSSPNETKYIISLDQDSVVKLE
NWTDASRVDGVVLEKVQEDEFRYRMYQTQVSDAGLYRCVVTAWSPVRGSLWREAATSLSN
PIEIDFQTAGPIFNASVHSDTPSVIRGDLIKLFCIIAVEGGALDPDDMAFDVSWFAVHSF
GLDKAPVLLSSLDRKGIVTTAERDRKSELSLERVGVLEFLLRVHGSEDQDFGNYYCSVTP
WVRSPTGSWQKEAEIYSKPIFVTVKMDVLNAFKYPLLIGVGLSTVIGLLSCLIGYCSSHW
CCKKEVQETRRERRRLMSMEMD
Download sequence
Identical sequences 9685.ENSFCAP00000001828 ENSFCAP00000001828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]