SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001996 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001996
Domain Number 1 Region: 225-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-22
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 3 Region: 15-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 283-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 5 Region: 378-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 186-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.76e-16
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 7 Region: 420-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000217
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 8 Region: 475-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000065
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001996   Gene: ENSFCAG00000002159   Transcript: ENSFCAT00000002159
Sequence length 526
Comment pep:novel genescaffold:CAT:GeneScaffold_2215:8189:19630:-1 gene:ENSFCAG00000002159 transcript:ENSFCAT00000002159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPQFSALSQEPQKMNTPQASVSFKDITVEFTQEEWRQMDSAQRTLYRDVMLENYSHLVSV
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDCQDDNLLEKSRQIQDRHLWQVLFT
HRELTQEGKVSGVTHKQTREIAEVTPFECGRNFSFANTPEKFCDYNKHRGALCPQQPGTR
TRIRLKPYECCGCGKCFCKKSYLLMHQRIHTGEKPYRCNECGKDFSHESSLWKQQRTHTG
ERPYECMECGKTFSWKSDLRVHQRTHTGEKPYECSECGKPLVQKSTPETHQTIHKGEKPY
ECNECQKTFTQNSPLRTHQTTHAGKKPYACKECGKAFNRKSSLGMHQRTHTEEKPYKCNT
CGKACSQKSGLRKHRTIHAGEKPNECDECGKAFSEKSGLQLHRRTHTGERPYKCNECDRA
FTYKSILRGHQEGHKREKLSKYDEGEKAFSEKSGLRLLQRTHPGEEPYDCREHGAFTSRS
VLTGHQEAPTGEEYCDERGEAFSHKSDFRKHQGTLTEEEHWNECGR
Download sequence
Identical sequences ENSFCAP00000001996 9685.ENSFCAP00000001996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]