SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002308 from Felis catus 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002308
Domain Number 1 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.73e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.91e-25
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 4 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.88e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 5 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-22
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 3-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 8 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 9 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.43e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 169-220
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-19
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000002308
Domain Number - Region: 134-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000141
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002308   Gene: ENSFCAG00000002508   Transcript: ENSFCAT00000002508
Sequence length 642
Comment pep:novel genescaffold:CAT:GeneScaffold_4754:492931:512899:-1 gene:ENSFCAG00000002508 transcript:ENSFCAT00000002508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKSQISFEDVAVDFTLEEWRLLNPTQKNLYRDVMLENYSNLVFLEVWLDNNLKMWHQDN
QDELRSMERGDECDVFRKIFHSSINFVHLAMRPHKCGTGEKHLKHRFEFLISKNNLGGKK
LDELSKKFLFYIKPDRTHGGIKHCDCNTCRKASSRESWLIADHITHTGVYLCMECGRVFN
KKSQLIIHQRTHTGEKPYGCSECGKAFSQKSLLTIHQRTHSGEKPYGCGECQKAFSRKSL
LILHQRTHTGEKPYGCSECGKAFSRKSQLKRHQRTHTVEKPFGCSDCGKAFSQKLKLITH
QRTHTGEKPYKCGDCGKAFFWKSQLITHQRTHTGKKPYACNECTKAFSRNSLLIRHQRIH
TGEKPYECRECGEAFVRKPQLVKHQVTHTGEKNYQCSDCEEAFFKKSELIRHQKTHLGEK
PYGCVECGKTFFGKSQLLTHQRTHTGEKPYECSECGRAFTQKSSLISHQRTHTGEKPYEC
RDCGKTFSEKSSLVHHQRTHTGEKPFECSECRKAFAWKPQLLRHQRIHTGEKPYECSECG
KAFVQKVQLIKHQRNHTGEKTYGCSECAKAFFEKAQLIIHQRIHTGERPYKCSECGKSFT
RKSHLMRHQRIHTGDKYYGCSECGTAFSRKSQLMAHQRTHVI
Download sequence
Identical sequences ENSFCAP00000002308 9685.ENSFCAP00000002308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]